PDB entry 2kxh

View 2kxh on RCSB PDB site
Description: Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox peptide
Class: protein binding
Keywords: RRM, FIR, FBP, protein-protein complex, PROTEIN BINDING
Deposited on 2010-05-05, released 2010-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Poly(U)-binding-splicing factor PUF60
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UHX1 (3-198)
    • expression tag (0-2)
  Domains in SCOPe 2.05: d2kxha1, d2kxha2
• Chain 'B':
  Compound: peptide of Far upstream element-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96AE4 (5-30)
    • expression tag (0-4)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kxhA (A:)
  gamaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafv
  eyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhq
  dlsdddiksvfeafgkiksctlardpttgkhkgygfieyekaqssqdavssmnlfdlggq
  ylrvgkavtppmplltpat
  

  
  
• Chain 'B':
  No sequence available.