PDB entry 2kxh

View 2kxh on RCSB PDB site
Description: Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox peptide
Class: protein binding
Keywords: RRM, FIR, FBP, protein-protein complex, PROTEIN BINDING
Deposited on 2010-05-05, released 2010-08-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (3-198)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2kxha1, d2kxha2, d2kxha3
  • Chain 'B':
    Compound: peptide of Far upstream element-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96AE4 (5-30)
      • expression tag (0-4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kxhA (A:)
    gamaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafv
    eyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhq
    dlsdddiksvfeafgkiksctlardpttgkhkgygfieyekaqssqdavssmnlfdlggq
    ylrvgkavtppmplltpat
    

  • Chain 'B':
    No sequence available.