PDB entry 2kxf

View 2kxf on RCSB PDB site
Description: Solution structure of the first two RRM domains of FBP-interacting repressor (FIR)
Class: protein binding
Keywords: rrm, RNA binding, protein binding
Deposited on 2010-05-04, released 2010-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (3-198)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d2kxfa1, d2kxfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kxfA (A:)
gamaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafv
eyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhq
dlsdddiksvfeafgkiksctlardpttgkhkgygfieyekaqssqdavssmnlfdlggq
ylrvgkavtppmplltpat