PDB entry 2kx3

View 2kx3 on RCSB PDB site
Description: The solution structure of the mutant of UBL domain of UBLCP1, I5M
Class: hydrolase
Keywords: UBL domain, UBLCP1, mutant, CTD-phosphatase, HYDROLASE
Deposited on 2010-04-23, released 2011-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like domain-containing CTD phosphatase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WVY7 (0-80)
      • engineered (4)
    Domains in SCOPe 2.05: d2kx3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kx3A (A:)
    malpmivkwggqeysvttlseddtvldlkqflktltgvlperqkllglkvkgkpaendvk
    lgalklkpntkimmmgtrees