PDB entry 2kwi

View 2kwi on RCSB PDB site
Description: RalB-RLIP76 (RalBP1) complex
Class: transport protein, protein binding
Keywords: transport protein, protein binding
Deposited on 2010-04-12, released 2010-09-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-B
    Species: Homo sapiens [TaxId:9606]
    Gene: RALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11234 (0-177)
      • engineered (64)
    Domains in SCOPe 2.05: d2kwia_
  • Chain 'B':
    Compound: RalA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RALBP1, RLIP1, RLIP76
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15311 (2-55)
      • expression tag (0-1)
      • engineered (20)
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kwiA (A:)
    gqsslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidil
    dtagledyaairdnyfrsgegfllvfsitehesftataefreqilrvkaeedkipllvvg
    nksdleerrqvpveearskaeewgvqyvetsaktranvdkvffdlmreirtkkmsenk
    

  • Chain 'B':
    No sequence available.