PDB entry 2kv4

View 2kv4 on RCSB PDB site
Description: egf
Class: hormone
Keywords: epithermal growth factor, EGF-like domain, HORMONE
Deposited on 2010-03-08, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kv4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kv4A (A:)
nsdsecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwelr