PDB entry 2kv3

View 2kv3 on RCSB PDB site
Description: Human Regenerating Gene Type IV (REG IV) PROTEIN, P91S mutant
Class: sugar binding protein
Keywords: GISP, C-type lectin, Reg IV, Reg 4, Disulfide bond, Glycoprotein, Lectin, Secreted, SUGAR BINDING PROTEIN
Deposited on 2010-03-04, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regenerating islet-derived protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: REG4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYZ8 (1-130)
      • expression tag (0)
      • engineered (63)
    Domains in SCOPe 2.07: d2kv3a1, d2kv3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kv3A (A:)
    qscapgwfyhksncygyfrklrnwsdaelecqsygngahlasilslkeastiaeyisgyq
    rsqsiwiglhdpqkrqqwqwidgamylyrswsgksmggnkhcaemssnnnfltwssnecn
    krqhflckyrp