PDB entry 2kuh

View 2kuh on RCSB PDB site
Description: Halothane binds to druggable sites in calcium-calmodulin: Solution structure of halothane-CaM C-terminal domain
Class: metal binding protein
Keywords: CALMODULIN, CALCIUM BINDING, VOLATILE ANESTHETIC, HALOTHANE, Cytoskeleton, Isopeptide bond, Methylation, Phosphoprotein, METAL BINDING PROTEIN
Deposited on 2010-02-17, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kuha_
  • Heterogens: CA, HLT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kuhA (A:)
    eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
    vqmmtak