PDB entry 2ktg

View 2ktg on RCSB PDB site
Description: Calmodulin like protein from Entamoeba histolytica: solution structure and calcium binding properties of a partially folded protein
Class: ca-binding protein
Keywords: EhCaM, Ca-binding protein, Entamoeba histolytica, partially structured protein, CaM-like
Deposited on 2010-02-01, released 2011-01-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin, putative
    Species: Entamoeba histolytica [TaxId:294381]
    Gene: EHI_100270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ktga_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ktgA (A:)
    mseqkkvltaeeqqeykeafqlfdkdndnkltaeelgtvmralganptkqkiseivkdyd
    kdnsgkfdqetfltimleygqevds