PDB entry 2ktb

View 2ktb on RCSB PDB site
Description: Solution Structure of the Second Bromodomain of Human Polybromo in complex with an acetylated peptide from Histone 3
Class: protein binding
Keywords: bromodomain, Alternative splicing, Chromatin regulator, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, PROTEIN BINDING
Deposited on 2010-01-26, released 2010-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: H3_Peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2KTB (0-19)
• Chain 'B':
  Compound: Protein polybromo-1
  Species: Homo sapiens [TaxId:9606]
  Gene: PB1, PBRM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86U86 (1-120)
    • expression tag (0)
  Domains in SCOPe 2.08: d2ktbb1, d2ktbb2

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ktbB (B:)
  stegsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlkt
  iaqriqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhem
  a