PDB entry 2ksc

View 2ksc on RCSB PDB site
Description: Solution structure of Synechococcus sp. PCC 7002 hemoglobin
Class: unknown function
Keywords: hemeprotein, 2/2 hemoglobin, GlbN, trHbN, UNKNOWN FUNCTION
Deposited on 2010-01-02, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ksca_
  • Heterogens: HEB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kscA (A:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr