PDB entry 2krr

View 2krr on RCSB PDB site
Description: Solution structure of the RBD1,2 domains from human nucleolin
Class: nuclear protein
Keywords: Acetylation, Cytoplasm, DNA-binding, Methylation, Nucleus, Phosphoprotein, Polymorphism, RNA-binding, NUCLEAR PROTEIN
Deposited on 2009-12-22, released 2010-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolin
    Species: Homo sapiens [TaxId:9606]
    Gene: NCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19338 (0-169)
      • expression tag (167)
      • expression tag (170-173)
    Domains in SCOPe 2.05: d2krra1, d2krra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2krrA (A:)
    gtepttafnlfvgnlnfnksapelktgisdvfakndlavvdvrigmtrkfgyvdfesaed
    lekaleltglkvfgneiklekpkgkdskkerdartllaknlpykvtqdelkevfedaaei
    rlvskdgkskgiayiefkteadaektfeekqgteidgrsislyytgepkgeglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2krrA (A:)
    gtepttafnlfvgnlnfnksapelktgisdvfakndlavvdvrigmtrkfgyvdfesaed
    lekaleltglkvfgneiklekpkgkdskkerdartllaknlpykvtqdelkevfedaaei
    rlvskdgkskgiayiefkteadaektfeekqgteidgrsislyytgepkgegle