PDB entry 2kot

View 2kot on RCSB PDB site
Description: Solution structure of S100A13 with a drug amlexanox
Class: signaling protein
Keywords: S100A13, SIGNALING PROTEIN, Calcium, Phosphoprotein
Deposited on 2009-09-30, released 2010-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kota_
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kotb_
  • Heterogens: ANW

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kotA (A:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kotB (B:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk