PDB entry 2ko3

View 2ko3 on RCSB PDB site
Description: Nedd8 solution structure
Class: signaling protein
Keywords: Nedd8, Isopeptide bond, Nucleus, Ubl conjugation pathway, SIGNALING PROTEIN
Deposited on 2009-09-09, released 2009-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ko3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ko3A (A:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg