PDB entry 2km8

View 2km8 on RCSB PDB site
Description: Interdomain RRM packing contributes to RNA recognition in the rna15, hrp1, anchor RNA 3' processing ternary complex
Class: RNA binding protein/RNA
Keywords: 3' processing, RRM domain, rna15p, hrp1p, enhancer element, positioning element, RNA recognition, mRNA processing, Nucleus, RNA-binding, Nonsense-mediated mRNA decay, Phosphoprotein, RNA binding protein-RNA COMPLEX
Deposited on 2009-07-24, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-r(p*up*ap*up*ap*up*ap*up*ap*ap*up*ap*ap*u)-3'
  • Chain 'B':
    Compound: mRNA 3'-end-processing protein rna15
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: 2.1, RNA15, YGL044C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2km8b_
  • Chain 'C':
    Compound: nuclear polyadenylated RNA-binding protein 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HRP1, NAB4, NAB5, YOL123W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2km8c1, d2km8c2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2km8B (B:)
    nppsrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessa
    savrnlngyqlgsrflkcgyssns
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2km8C (C:)
    kesckmfigglnwdttednlreyfgkygtvtdlkimkdpatgrsrgfgflsfekpssvde
    vvktqhildgkvidpkraiprdeqdktgkifvggigpdvrpkefeeffsqwgtiidaqlm
    ldkdtgqsrgfgfvtydsadavdrvcqnkfidfkdrkieikraeprh