PDB entry 2klc

View 2klc on RCSB PDB site
Description: NMR solution structure of human ubiquitin-like domain of ubiquilin 1, Northeast Structural Genomics Consortium (NESG) target HT5A
Class: Structural Genomics, Unknown function
Keywords: ubiquitin-like, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Structural Genomics Consortium, SGC, protein binding, UBL, Ontario Centre for Structural Proteomics, OCSP, proteasome, ubiquitin ligase-associated, ubiquitination, protein degradation, Alzheimer's, Nucleus, Phosphoprotein, Unknown function, Ontario Centre for Structural Proteomics (OCSP)
Deposited on 2009-06-30, released 2009-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DA41, PLIC1, UBQLN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2klca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2klcA (A:)
    mgsshhhhhhssgrenlyfqghpkimkvtvktpkekeefavpenssvqqfkeeiskrfks
    htdqlvlifagkilkdqdtlsqhgihdgltvhlviktqnrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2klcA (A:)
    pkimkvtvktpkekeefavpenssvqqfkeeiskrfkshtdqlvlifagkilkdqdtlsq
    hgihdgltvhlviktqnrp