PDB entry 2kkq

View 2kkq on RCSB PDB site
Description: Solution NMR Structure of the Ig-like C2-type 2 Domain of Human Myotilin. Northeast Structural Genomics Target HR3158.
Class: structural protein
Keywords: unknown function, Actin-binding, Cell membrane, Cytoplasm, Cytoskeleton, Disease mutation, Immunoglobulin domain, Limb-girdle muscular dystrophy, Membrane, Muscle protein, Polymorphism, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL PROTEIN
Deposited on 2009-06-29, released 2009-07-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myotilin
  Species: Homo sapiens [TaxId:9606]
  Gene: MYOT, TTID
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBF9 (10-115)
    • expression tag (0-9)
  Domains in SCOPe 2.05: d2kkqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kkqA (A:)
  mghhhhhhshehkrapmfiykpqskkvlegdsvklecqisaipppklfwkrnnemvqfnt
  drislyqdntgrvtllikdvnkkdagwytvsavneagvttcntrldvtarpnqtlp