PDB entry 2kko
View 2kko on RCSB PDB site
Description: Solution NMR structure of the homodimeric winged helix-turn-helix DNA-binding domain (fragment 1-100) Mb0332 from Mycobacterium bovis, a possible ArsR-family transcriptional regulator. Northeast Structural Genomics Consortium Target MbR242E.
Class: DNA binding protein
Keywords: NESG, DNA-BINDING, TRANSCRIPTION REGULATION, TRANSCRIPTIONAL REGULATOR, wHTH, HOMODIMER, winged helix-turn-helix, Transcription, Transferase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, DNA BINDING PROTEIN
Deposited on
2009-06-26, released
2009-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated
2010-01-26, with a file datestamp of
2010-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: possible transcriptional regulatory protein (possibly arsr-family)
Species: Mycobacterium bovis [TaxId:1765]
Gene: Mb0332
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kkoa1, d2kkoa2 - Chain 'B':
Compound: possible transcriptional regulatory protein (possibly arsr-family)
Species: Mycobacterium bovis [TaxId:1765]
Gene: Mb0332
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kkob1, d2kkob2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2kkoA (A:)
magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
alksgglvearregtrqyyriagedvarlfalvqvvadehlehhhhhh
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2kkoB (B:)
magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
alksgglvearregtrqyyriagedvarlfalvqvvadehlehhhhhh