PDB entry 2kko

View 2kko on RCSB PDB site
Description: Solution NMR structure of the homodimeric winged helix-turn-helix DNA-binding domain (fragment 1-100) Mb0332 from Mycobacterium bovis, a possible ArsR-family transcriptional regulator. Northeast Structural Genomics Consortium Target MbR242E.
Class: DNA binding protein
Keywords: NESG, DNA-BINDING, TRANSCRIPTION REGULATION, TRANSCRIPTIONAL REGULATOR, wHTH, HOMODIMER, winged helix-turn-helix, Transcription, Transferase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, DNA BINDING PROTEIN
Deposited on 2009-06-26, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible transcriptional regulatory protein (possibly arsr-family)
    Species: Mycobacterium bovis [TaxId:1765]
    Gene: Mb0332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7U294 (0-99)
      • expression tag (100-107)
    Domains in SCOPe 2.07: d2kkoa1, d2kkoa2
  • Chain 'B':
    Compound: possible transcriptional regulatory protein (possibly arsr-family)
    Species: Mycobacterium bovis [TaxId:1765]
    Gene: Mb0332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7U294 (0-99)
      • expression tag (100-107)
    Domains in SCOPe 2.07: d2kkob1, d2kkob2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kkoA (A:)
    magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
    alksgglvearregtrqyyriagedvarlfalvqvvadehlehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kkoB (B:)
    magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
    alksgglvearregtrqyyriagedvarlfalvqvvadehlehhhhhh