PDB entry 2kkd

View 2kkd on RCSB PDB site
Description: NMR Structure of Ni Substitued Desulfovibrio vulgaris Rubredoxin
Class: electron transport
Keywords: electron transport, [Fe-4S], iron, metal-binding, Cytoplasm, Transport
Deposited on 2009-06-18, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris str. Hildenborough [TaxId:882]
    Gene: rub, DVU_3184
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kkda_
  • Heterogens: NI

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kkdA (A:)
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa