PDB entry 2kk6

View 2kk6 on RCSB PDB site
Description: Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
Class: transferase
Keywords: methods development, SH2, Proto-oncogene tyrosine-protein kinase FER, NESG, NMR, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Proto-oncogene, SH2 domain, Transferase, Tyrosine-protein kinase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2009-06-15, released 2009-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase FER
  Species: Homo sapiens [TaxId:9606]
  Gene: FER, TYK3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16591 (11-115)
    • expression tag (0-10)
  Domains in SCOPe 2.06: d2kk6a1, d2kk6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kk6A (A:)
  mghhhhhhshmkplaeqdwyhgaiprieaqellkkqgdflvreshgkpgeyvlsvysdgq
  rrhfiiqyvdnmyrfegtgfsnipqlidhhyttkqvitkksgvvllnpipkdkkwi