PDB entry 2kjr

View 2kjr on RCSB PDB site
Description: Solution NMR structure of the N-terminal Ubiquitin-like Domain from Tubulin-binding Cofactor B, CG11242, from Drosophila melanogaster. Northeast Structural Genomics Consortium Target FR629A (residues 8-92)
Class: chaperone
Keywords: ubl, ubiquitin, ubiquitin-like, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN, CHAPERONE
Deposited on 2009-06-08, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg11242
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG11242, Dmel_CG11242
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1ZBM2 (10-94)
      • expression tag (0-9)
    Domains in SCOPe 2.06: d2kjra1, d2kjra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kjrA (A:)
    mghhhhhhshgksdfikvnvsnshndavafevklakdltvaqlktkleiltggcagtmkv
    qvfkgdtcvstmdnndaqlgyyansdglrlhvvds