PDB entry 2ki4

View 2ki4 on RCSB PDB site
Description: FGF1-S100A13 complex structure: key component in non-classical path way of FGF1
Class: protein transport
Keywords: acidic fibroblast growth factor, S100A13, tetrameric complex, Acetylation, Alternative splicing, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, Calcium, PROTEIN TRANSPORT
Deposited on 2009-04-27, released 2010-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki4a_
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99584 (0-97)
      • see remark 999 (96-97)
    Domains in SCOPe 2.04: d2ki4b_
  • Chain 'C':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99584 (0-97)
      • see remark 999 (93)
    Domains in SCOPe 2.04: d2ki4c_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ki4A (A:)
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ki4B (B:)
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ki4C (C:)
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ki4D (D:)
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd