PDB entry 2ki2

View 2ki2 on RCSB PDB site
Description: Solution Structure of ss-DNA Binding Protein 12RNP2 Precursor, HP0827(O25501_HELPY) form Helicobacter pylori
Class: RNA BINDING PROTEIN/ss-DNA BINDING PROTEIN
Keywords: HP0827, Helicobacter Pylori, NMR, RRM, RNP1, RNP2, ss-DNA binding proteins, RNA BINDING PROTEIN/ss-DNA BINDING PROTEIN COMPLEX
Deposited on 2009-04-20, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ss-DNA binding protein 12RNP2
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ki2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ki2A (A:)
    mrniyvgnlvysatseqvkelfsqfgkvfnvkliydretkkpkgfgfvemqeesvseaia
    kldntdfmgrtirvteanpkkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ki2A (A:)
    mrniyvgnlvysatseqvkelfsqfgkvfnvkliydretkkpkgfgfvemqeesvseaia
    kldntdfmgrtirvtea