PDB entry 2khn

View 2khn on RCSB PDB site
Description: NMR solution structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646E.
Class: signaling protein
Keywords: NMR, GFT NMR, high throughput, NESGC, human intersectin-1, Alternative splicing, Calcium, Cell junction, Cell projection, Coiled coil, Endocytosis, Membrane, Phosphoprotein, SH3 domain, Synapse, Synaptosome, SIGNALING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2009-04-09, released 2009-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Intersectin-1
  Species: Homo sapiens [TaxId:9606]
  Gene: ITSN1, ITSN, SH3D1A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15811 (10-120)
    • expression tag (0-9)
    • see remark 999 (23)
  Domains in SCOPe 2.05: d2khna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2khnA (A:)
  mghhhhhhshmaqfptpfggsldtwaitveerakhdqqfhslkpisgfitgdqarnfffq
  sglpqpvlaqiwaladmnndgrmdqvefsiamkliklklqgyqlpsalppvmkqqpvais
  s