PDB entry 2kg0
View 2kg0 on RCSB PDB site
Description: Structure of the second qRRM domain of hnRNP F in complex with a AGGGAU G-tract RNA
Class: RNA binding protein/RNA
Keywords: protein-RNA complex, G tract, splicing regulation, polyadenylation regulation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on
2009-03-02, released
2010-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2010-07-21, with a file datestamp of
2010-07-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: heterogeneous nuclear ribonucleoprotein F
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2kg0a_ - Chain 'B':
Compound: 5'-r(*ap*gp*gp*gp*ap*u)-3'
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2kg0A (A:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsnsadsandgfvrlrglpfgctkeeiv
qffsgleivpngitlpvdpegkitgeafvqfasqelaekalgkhkerighryievfkssq
eevrsy
Sequence, based on observed residues (ATOM records): (download)
>2kg0A (A:)
nsadsandgfvrlrglpfgctkeeivqffsgleivpngitlpvdpegkitgeafvqfasq
elaekalgkhkerighryievfkssqeevrsy
- Chain 'B':
No sequence available.