PDB entry 2kfy

View 2kfy on RCSB PDB site
Description: NMR structure of the first qRRM of hnRNP F in complex with AGGGAU G-tract RNA
Class: RNA binding protein/RNA
Keywords: protein-RNA complex, G tract, splicing regulation, polyadenylation regulation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2009-03-02, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kfya_
  • Chain 'B':
    Compound: 5'-r(*ap*gp*gp*gp*ap*u)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kfyA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmmlgpeggegfvvklrglpwscsved
    vqnflsdctihdgaagvhfiytregrqsgeafvelgseddvkmalkkdresmghryievf
    kshrtemdwvlkhsgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kfyA (A:)
    mmlgpeggegfvvklrglpwscsvedvqnflsdctihdgaagvhfiytregrqsgeafve
    lgseddvkmalkkdresmghryievfkshrtemdwvlkhsgp
    

  • Chain 'B':
    No sequence available.