PDB entry 2kdg

View 2kdg on RCSB PDB site
Description: Solution Structure of the 1st Ig domain of Myotilin
Class: structural protein
Keywords: Myotilin, Immonoglobulin domain, actin-binding, STRUCTURAL PROTEIN, Cell membrane, Cytoplasm, Cytoskeleton, Disease mutation, Immunoglobulin domain, Limb-girdle muscular dystrophy, Membrane, Muscle protein, Polymorphism
Deposited on 2009-01-08, released 2009-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotilin
    Species: Homo sapiens [TaxId:9606]
    Gene: MYOT, TTID
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBF9 (4-99)
      • expression tag (0-3)
    Domains in SCOPe 2.04: d2kdga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kdgA (A:)
    gamgpprfiqvpenmsidegrfcrmdfkvsglpapdvswylngrtvqsddlhkmivsekg
    lhslifevvrasdagayacvaknrageatftvqldvlake