PDB entry 2kdb

View 2kdb on RCSB PDB site
Description: Solution Structure of human ubiquitin-like domain of Herpud2_9_85, Northeast Structural Genomics Consortium (NESG) target HT53A
Class: protein binding
Keywords: ubl domain, Membrane, Transmembrane, Unfolded protein response, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP, unknown function, PROTEIN BINDING, SGC
Deposited on 2009-01-06, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HERPUD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kdba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kdbA (A:)
    mgsshhhhhhssgrenlyfqghpvtliikapnqkysdqtiscflnwtvgklkthlsnvyp
    skpltkdqrlvysgrllpdhlqlkdilrkqdeyhmvhlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kdbA (A:)
    pvtliikapnqkysdqtiscflnwtvgklkthlsnvypskpltkdqrlvysgrllpdhlq
    lkdilrkqdeyhmvhlv