PDB entry 2kdb

View 2kdb on RCSB PDB site
Description: Solution Structure of human ubiquitin-like domain of Herpud2_9_85, Northeast Structural Genomics Consortium (NESG) target HT53A
Class: protein binding
Keywords: ubl domain, Membrane, Transmembrane, Unfolded protein response, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP, unknown function, PROTEIN BINDING, SGC
Deposited on 2009-01-06, released 2009-02-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: HERPUD2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BSE4 (22-98)
  Domains in SCOPe 2.04: d2kdba_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2kdbA (A:)
  mgsshhhhhhssgrenlyfqghpvtliikapnqkysdqtiscflnwtvgklkthlsnvyp
  skpltkdqrlvysgrllpdhlqlkdilrkqdeyhmvhlv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2kdbA (A:)
  pvtliikapnqkysdqtiscflnwtvgklkthlsnvypskpltkdqrlvysgrllpdhlq
  lkdilrkqdeyhmvhlv