PDB entry 2kcq

View 2kcq on RCSB PDB site
Description: Solution structure of protein SRU_2040 from Salinibacter ruber (strain DSM 13855) . Northeast Structural Genomics Consortium target SrR106
Class: structural genomics, unknown function
Keywords: nmr, NESG, structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, unknown function, NUCLEOTIDE-BINDING PROTEIN
Deposited on 2008-12-28, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mov34/MPN/PAD-1 family
    Species: Salinibacter ruber DSM 13855 [TaxId:309807]
    Gene: SRU_2040
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2S0Y5 (0-144)
      • expression tag (145-152)
    Domains in SCOPe 2.07: d2kcqa1, d2kcqa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kcqA (A:)
    mkttpdildqirvhgadaypeegcgfllgtvtddgdnrvaalhratnrrseqrtrryelt
    addyraadaaaqeqgldvvgvyhshpdhparpsatdleeatfpgftyvivsvrdgapeal
    tawalapdrsefhredivrpdpeaplehhhhhh