PDB entry 2kcj

View 2kcj on RCSB PDB site
Description: solution structure of FAPP1 PH domain
Class: membrane protein
Keywords: FAPP1, PH domain, Lipid-binding, Membrane, MEMBRANE PROTEIN
Deposited on 2008-12-22, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family A member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHA3, FAPP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB20 (8-107)
      • expression tag (0-7)
      • engineered (101)
    Domains in SCOPe 2.07: d2kcja1, d2kcja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kcjA (A:)
    gplgspefmegvlykwtnyltgwqprwfvldngilsyydsqddvckgskgsikmavceik
    vhsadntrmeliipgeqhfymkavnaaerqrwlvalgsskasltdtrt