PDB entry 2kbm

View 2kbm on RCSB PDB site
Description: Ca-S100A1 interacting with TRTK12
Class: metal binding protein
Keywords: S100, EF-hand, Protein-protein interaction, conformational change, CapZ, Acetylation, Actin capping, Actin-binding, Calcium, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN
Deposited on 2008-12-02, released 2009-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-A1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: S100a1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35467 (0-92)
  Domains in SCOPe 2.08: d2kbma_
• Chain 'B':
  Compound: Protein S100-A1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: S100a1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35467 (0-92)
  Domains in SCOPe 2.08: d2kbmb_
• Chain 'X':
  Compound: F-actin-capping protein subunit alpha-2
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Capza2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3T1K5 (0-11)
• Chain 'Y':
  Compound: F-actin-capping protein subunit alpha-2
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Capza2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3T1K5 (0-11)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kbmA (A:)
  gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
  ldengdgevdfqefvvlvaaltvacnnffwens
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kbmB (B:)
  gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
  ldengdgevdfqefvvlvaaltvacnnffwens
  

  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.