PDB entry 2kbe

View 2kbe on RCSB PDB site
Description: solution structure of amino-terminal domain of Dbp5p
Class: hydrolase
Keywords: dbp5p, ATP-binding, Cytoplasm, Helicase, Hydrolase, Membrane, mRNA transport, Nuclear pore complex, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, RNA-binding, Translocation, Transport
Deposited on 2008-11-27, released 2009-10-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2kbea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kbeA (A:)
    yevkvkladiqadpnsplysaksfdelglapellkgiyamkfqkpskiqeralplllhnp
    prnmiaqsqsgtgktaafsltmltrvnpedaspqaiclapsrelarqtlevvqemgkftk
    itsqlivpdsfeknkqinaqvivgtpgtvldlmrrklmqlqkikifvldeadnmldqqgl
    gdqcirvkrflpkdtqlvlfsatfadavrqyakkivpnantlelqt