PDB entry 2kb0

View 2kb0 on RCSB PDB site
Description: Cdc42(T35A)
Class: signaling protein
Keywords: globular, folded, Switch 1, mutation, Ras, Alternative splicing, Cell membrane, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, SIGNALING PROTEIN
Deposited on 2008-11-18, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (0-177)
      • engineered (34)
      • variant (162)
    Domains in SCOPe 2.08: d2kb0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kb0A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvpavfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale