PDB entry 2kax

View 2kax on RCSB PDB site
Description: Solution structure and dynamics of S100A5 in the apo and Ca2+ -bound states
Class: metal binding protein
Keywords: S100A5, EF-hand, Calcium binding protien, Calcium, Polymorphism, Structural Genomics, SPINE2, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN
Deposited on 2008-11-17, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kaxa_
  • Chain 'B':
    Compound: Protein S100-A5
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kaxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kaxA (A:)
    metplekalttmvttfhkysgregskltlsrkelkelikkelclgemkessiddlmksld
    knsdqeidfkeysvfltmlcmayndfflednk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kaxB (B:)
    metplekalttmvttfhkysgregskltlsrkelkelikkelclgemkessiddlmksld
    knsdqeidfkeysvfltmlcmayndfflednk