PDB entry 2kac

View 2kac on RCSB PDB site
Description: NMR solution structure of KX6E protL mutant
Class: immune system
Keywords: protein, cell wall, peptidoglycan-anchor, immune system
Deposited on 2008-11-04, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: PEPTOSTREPTOCOCCUS MAGNUS [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (1-63)
      • initiating methionine (0)
      • engineered (22)
      • engineered (27)
      • engineered (40-41)
      • conflict (46)
      • engineered (53)
      • engineered (60)
    Domains in SCOPe 2.08: d2kaca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kacA (A:)
    meevtikanlifangstqtaefegtfeeatseayayadtleedngewtvdvadegytlni
    efag