PDB entry 2ka3

View 2ka3 on RCSB PDB site
Description: Structure of EMILIN-1 C1Q-like domain
Class: structural protein
Keywords: EMILIN-1, C1Q-like domain, Homotrimeric protein complex, Beta-sandwich, Structural protein, Cell adhesion, extracellular matrix
Deposited on 2008-10-30, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EM1, EMILIN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ka3a_
  • Chain 'B':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EM1, EMILIN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ka3b_
  • Chain 'C':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EM1, EMILIN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ka3c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ka3A (A:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ka3A (A:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ka3B (B:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ka3B (B:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ka3C (C:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ka3C (C:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha