PDB entry 2k9z

View 2k9z on RCSB PDB site
Description: NMR structure of the protein TM1112
Class: structural genomics, unknown function
Keywords: Thermotoga Maritima, TM1112, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, unknown function
Deposited on 2008-10-28, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein TM1112
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_1112
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2k9za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k9zA (A:)
    mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvi
    ekgdlvtfpkglrcrwkvlepvrkhynlf