PDB entry 2k8g

View 2k8g on RCSB PDB site
Description: Solution structure of RRM2 domain of PABP1
Class: translation
Keywords: protein, Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, TRANSLATION
Deposited on 2008-09-09, released 2009-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPC1, PAB1, PABP1, PABPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11940 (2-94)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d2k8ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k8gA (A:)
    gadpslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfet
    qeaaeraiekmngmllndrkvfvgrfksrkereae