PDB entry 2k7q

View 2k7q on RCSB PDB site
Description: Filamin A Ig-like domains 18-19
Class: structural protein
Keywords: filamin, Ig-like, ABP-280, actin binding protein, Acetylation, Actin-binding, Cytoplasm, Cytoskeleton, Disease mutation, Phosphoprotein, Polymorphism, STRUCTURAL PROTEIN
Deposited on 2008-08-19, released 2009-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21333 (3-190)
    • expression tag (0-2)
  Domains in SCOPe 2.06: d2k7qa1, d2k7qa2, d2k7qa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k7qA (A:)
  gamgddsmrmshlkvgsaadipinisetdlslltatvvppsgreepcllkrlrnghvgis
  fvpketgehlvhvkkngqhvasspipvvisqseigdasrvrvsgqglheghtfepaefii
  dtrdagygglslsiegpskvdintedledgtcrvtycptepgnyiinikfadqhvpgspf
  svkvtgegrvk