PDB entry 2k61

View 2k61 on RCSB PDB site
Description: Solution structure of CaM complexed to DAPk peptide
Class: metal binding protein
Keywords: calmodulin, DAPk peptide, Methylation, Phosphoprotein, METAL BINDING PROTEIN
Deposited on 2008-07-02, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-147)
      • engineered (59)
    Domains in SCOPe 2.07: d2k61a_
  • Heterogens: CA, TB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k61A (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k61A (A:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgdgt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak