PDB entry 2k5u

View 2k5u on RCSB PDB site
Description: Solution structure of myirstoylated yeast ARF1 protein, GDP-bound
Class: signaling protein
Keywords: ARF, ARF1, myristoyl, myrsitoylated, GDP, ER-Golgi transport, Golgi apparatus, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Protein transport, Transport, SIGNALING PROTEIN
Deposited on 2008-06-30, released 2009-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-27, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ADP-ribosylation factor 1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: ARF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11076 (1-180)
    • insertion (0)
  Domains in SCOPe 2.05: d2k5ua_
• Heterogens: GDP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k5uA (A:)
  xglfasklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqykn
  isftvwdvggqdrirslwrhyyrntegvifvvdsndrsrigearevmqrmlnedelrnaa
  wlvfankqdlpeamsaaeiteklglhsirnrpwfiqatcatsgeglyeglewlsnslkns
  t