PDB entry 2k4w

View 2k4w on RCSB PDB site
Description: The Solution Structure of the Monomeric Copper, Zinc Superoxide Dismutase from Salmonella enterica
Class: oxidoreductase
Keywords: Superoxide Dismutase, Solution Structures, metalloenzymes, bioinorganic chemistry, Copper, Metal-binding, Oxidoreductase, Zinc, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, Structural Proteomics in Europe, SPINE
Deposited on 2008-06-20, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Salmonella enterica subsp. enterica serovar Choleraesuis [TaxId:119912]
    Gene: sodC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q704S6 (0-153)
      • engineered (5)
    Domains in SCOPe 2.07: d2k4wa_
  • Heterogens: CU1, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k4wA (A:)
    asekvgmnlvtaqgvgqsigtvvidetegglkftphlkalppgehgfhihangscqpaik
    dgqavaaeaagghldpqntgkhegpegqghlgdlpvlvvnndgiatepvtaprlksldev
    kdkalmihvggdnmsdqpkplggggtryacgvik