PDB entry 2k3s

View 2k3s on RCSB PDB site
Description: HADDOCK-derived structure of the CH-domain of the smoothelin-like 1 complexed with the C-domain of apocalmodulin
Class: protein binding
Keywords: apocalmodulin complex, calponin homology domain, smoothelin-like 1, HADDOCK model, CH-domain, Coiled coil, Acetylation, Calcium, Methylation, PROTEIN BINDING
Deposited on 2008-05-15, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Smoothelin-like protein 1
    Species: MUS MUSCULUS
    Gene: Smtnl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99LM3 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2k3sa1, d2k3sa2
  • Chain 'B':
    Compound: calmodulin
    Species: Xenopus laevis
    Gene: calm1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k3sb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3sA (A:)
    gplgsknmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakr
    rhnftlafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3sB (B:)
    eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
    vqmmtak