PDB entry 2k3k

View 2k3k on RCSB PDB site
Description: Solution structure of Drosophila melanogaster SNF RBD1
Class: RNA binding protein
Keywords: RNA BINDING PROTEIN, SNF RBD1, RNA binding, RNA splicing, solution structure, mRNA processing, mRNA splicing, Nucleus, Ribonucleoprotein, RNA-binding, Spliceosome
Deposited on 2008-05-12, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43332 (0-97)
      • expression tag (98-103)
    Domains in SCOPe 2.06: d2k3ka1, d2k3ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3kA (A:)
    memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
    sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk