PDB entry 2k2x

View 2k2x on RCSB PDB site
Description: Solution Structure of Tick Carboxypeptidase Inhibitor at pH 3.5
Class: hydrolase inhibitor
Keywords: TCI, Blood coagulation, Fibrinolysis, Metalloenzyme inhibitor, Metalloprotease inhibitor, Secreted, HYDROLASE INHIBITOR
Deposited on 2008-04-15, released 2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: carboxypeptidase inhibitor
  Species: Rhipicephalus bursa
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5EPH2 (0-74)
  Domains in SCOPe 2.08: d2k2xa1, d2k2xa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k2xA (A:)
  necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
  sascgkgqkccvwlh