PDB entry 2k2g

View 2k2g on RCSB PDB site
Description: Solution structure of the wild-type catalytic domain of human matrix metalloproteinase 12 (MMP-12) in complex with a tight-binding inhibitor
Class: hydrolase
Keywords: macrophage elastase, matrix metalloproteinase, protein-ligand structure, catalytic domain, human gene, Calcium, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2008-04-01, released 2008-05-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-164)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d2k2ga1
  • Heterogens: ZN, DSV

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2gA (A:)
    mfrempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmad
    ilvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavh
    eighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg