PDB entry 2k2a

View 2k2a on RCSB PDB site
Description: Solution Structure of the Apo C terminal domain of Lethocerus troponin C isoform F1
Class: contractile protein
Keywords: contractile protein, calcium binding protein
Deposited on 2008-03-29, released 2009-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Lethocerus indicus [TaxId:212017]
    Gene: tnC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2k2aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k2aA (A:)
    mqqelreafrlydkegngyistdvmreilaeldetlssedldamideidadgsgtvdfee
    fmgvmtggde