PDB entry 2k1q

View 2k1q on RCSB PDB site
Description: NMR structure of hepatitis c virus ns3 serine protease complexed with the non-covalently bound phenethylamide inhibitor
Class: viral protein
Keywords: SERINE PROTEASE, NS3, HEPATITIS C VIRUS, NON COVALENT INHIBITOR, Envelope protein, Helicase, Hydrolase, Nucleotide-binding, RNA replication, Transmembrane, VIRAL PROTEIN
Deposited on 2008-03-13, released 2009-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-03, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90191 (Start-179)
      • expression tag (180-185)
    Domains in SCOPe 2.08: d2k1qa1, d2k1qa2
  • Chain 'B':
    Compound: phenethylamide
    Database cross-references and differences (RAF-indexed):
    • PDB 2K1Q (0-4)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2k1qA (A:)
apitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr
askkkk

    Sequence, based on observed residues (ATOM records): (download) 
    >2k1qA (A:)
tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk

  • Chain 'B':
    No sequence available.